PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_9.189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HB-other
Protein Properties Length: 1033aa    MW: 114066 Da    PI: 8.8039
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_9.189genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox171e-0569125157
                                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                  +r+R  ++ + ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +Ra+ +k
  evm.model.supercontig_9.189  69 KRPRDLLNLKAVKYMQAVFSIKDAISKKESREISALFGVTVTQVRDFFTSQRARVRK 125
                                  68999999999*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.89666126IPR001356Homeobox domain
SMARTSM003893.0E-468130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-669136IPR009057Homeodomain-like
SuperFamilySSF466892.44E-669130IPR009057Homeodomain-like
CDDcd000861.06E-469126No hitNo description
Gene3DG3DSA:1.20.930.109.9E-5242334IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1033 aa     Download sequence    Send to blast
MEVLKDDFQD IEIGSSVESL ERLLESQREL FHSQIDQLQN IVVTQCKLTG VNPLAQEMAA  60
GALSIKIGKR PRDLLNLKAV KYMQAVFSIK DAISKKESRE ISALFGVTVT QVRDFFTSQR  120
ARVRKQVRLS REKSIRSNAH KEQHDVALTS YDSNIPIEPV PLNSVPTESD PIRPIEPVPL  180
NSIGPPTADE LPSCSTQNDI PSTIDELEKH FIDNIFSMMH KEETFSGQVK LMEWILQMQN  240
SAVLNWFLAK GSVMILAAWL SQAAIEEQTS VLLVILEVLC HLPLHKALPE HMSAILQSVN  300
RLRFYRTSDI SNRARILLAR WSKLFARSQA MKKTNGVKST TDVHSQMLLK QSIVEIMGDE  360
SWSSSIGIPE EIIAPKHESS ENLRKLESSQ APKLLLGSSD DSARKHILGA SSSYTRERRK  420
VQLVEQPGSK TAGRSTQSGR AVSLNQGRPM SADDIQKAKL RAQYMQSKYG KMGSSSNGSG  480
EAKTECIKKL SAIQSSNLSP ISKFHVWAKT DEHKKPVTVA TKVSNDLEVS LDSKHKMNPE  540
EPLQEDCKRV QIPWRVPPEI SFQDVWRVGA GESSKEIDVE RNRNRREKET IYPAIQNIPP  600
NPKEPWDLEM DYDDSLTLEI PTEQPPDTDT SEAHTTGQQV SSFQDVNVAV TLGPTSSDNI  660
GGGNTAEPDL ELLGVLLKNP ELVIALTSGQ AGNFSSQETV KLLDMIKAGG SGLASNLNGF  720
NTKVEEKIEV SLPSPTPSSN SGMSGWRPEA VRNPFSQQTP MGSIVTSVDK PPAASLARPQ  780
IPASNITIHQ QQSSSVPLHS QHVQAAIPPF SLPHKSIVAP EKHQTPIVHS LHRSLHANSP  840
ASPIMSTQSA DVALATKTNL LSVAGRPSLR METITNNAKP STLLMTQERQ PVSLQFPTST  900
WRQAPLQPDS PVHAPSYSSR QPMGNAGAVP DSWRGRLGLG SNPYSPSNQN GYNASSHGQP  960
LSAPQWEGTE QAGSDGFESW SPENSPRSKS PKYMRGRNLG ESRMNSGWDR LDRSRQQNSP  1020
RNWDRRWRDR SR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050831.10.0Homeodomain-like superfamily protein, putative
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A061DY790.0A0A061DY79_THECC; Homeodomain-like superfamily protein, putative
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein